PeptideVAE: Hyperbolic Antimicrobial Peptide Predictor
PeptideVAE is a Transformer-based Variational Autoencoder (VAE) designed for the analysis and design of antimicrobial peptides (AMPs). It leverages hyperbolic geometry (Poincaré ball) to learn a structured latent space where radial distance encodes antimicrobial potency (MIC).
Model Description
- Architecture: Transformer Encoder-Decoder with Hyperbolic Projection.
- Latent Space: 16-dimensional Poincaré ball (curvature $c=1.0$).
- Input: Peptide sequences (length 10-50 AA).
- Task: Regression (Log10 MIC prediction) and Sequence Generation.
Key Features
- Biological Grounding: Stress-tested for sensitivity to physicochemical properties. Correctly predicts reduced activity when positive charge density is decreased (e.g., K $ ightarrow$ E mutation in LL-37).
- Hyperbolic Hierarchy: Higher antimicrobial activity (lower MIC) correlates with specific radial positioning in the hyperbolic manifold.
- Multimodal Embedding: Combines amino acid identity, 5-adic physicochemical groups, and standard AA properties.
Performance (5-Fold Cross-Validation)
| Metric | Mean Value | Max (Best Fold) |
|---|---|---|
| Spearman $ | ||
| ho$ | 0.633 | 0.760 |
| Pearson $r$ | 0.618 | 0.749 |
| MAE | 0.32 Log10 units | 0.25 |
| Reconstruction | 100% | 100% |
Usage
import torch
from peptide_vae import PeptideVAE
# Load model
model = PeptideVAE(latent_dim=16, hidden_dim=64)
checkpoint = torch.load("pytorch_model.bin", map_location="cpu")
model.load_state_dict(checkpoint["model_state_dict"])
model.eval()
# Encode sequence
seq = "[LL-37, 37 aa]"
with torch.no_grad():
out = model.encode([seq])
z_hyp = out['z_hyp']
mic_pred = model.predict_mic(z_hyp)
print(f"Predicted Log10(MIC): {mic_pred.item():.4f}")
Citation
If you use this model in your research, please cite:
@software{peptide_vae_2026,
author = {AI Whisperers},
title = {PeptideVAE: Hyperbolic Antimicrobial Peptide Predictor},
year = {2026},
url = {https://huggingface.co/ai-whisperers/peptide-vae-amp}
}
Inference Providers NEW
This model isn't deployed by any Inference Provider. 🙋 Ask for provider support